General Information

  • ID:  hor006528
  • Uniprot ID:  P08932
  • Protein name:  T-kininogen 2 light chain
  • Gene name:  NA
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NA
  • Source:  Animal
  • Expression:  In response to an inflammatory stimulant. T-kininogen II synthesis is induced and the plasma concentration of T-kininogen I is raised.|Plasma.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0006953 acute-phase response; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0030195 negative regulation of blood coagulation; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LVQVQETKEGTTRLLNSCEYKGRLSKAGAGPAPDHQAEASTVTP
  • Length:  44(387-430)
  • Propeptide:  MKLITILLLCSRLLPSLAQEEGAQEMDCNDETVFQAVDTALKKYNAELESGNQFLLYRVTEGTKKDGAETLYSFKYQIKEGNCSVQSGLTWQDCDFKDAEEAATGECTTTLGKKENKFSVATQICNITPGKGPKKTEEDLCVGCFQPIPMDSSDLKPVLKHAVEHFNNNTKHTHLFALTEVKSAHSQVVAGMNYKIIYSIVQTNCSKEDFPFLREDCVPLPYGDHGECRGHTYVDIHNTIAGFSQSCDLYPGDDL
  • Signal peptide:  MKLITILLLCSRLLPSLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Kininogens are plasma glycoproteins with a number of functions: (1) as precursor of the active peptide bradykinin they effect smooth muscle contraction, induction of hypotension and increase of vascular permeability. (2) They play a role in blood coagulat
  • Mechanism:  Rats express four types of kininogens: the classical HMW and LMW kininogens produced by alternative splicing of the same gene, and two additional LMW-like kininogens: T-I and T-II.
  • Cross BBB:  NA
  • Target:  Bdkrb2
  • Target Unid:  P25023
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08932-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006528_AF2.pdbhor006528_ESM.pdb

Physical Information

Mass: 540733 Formula: C197H325N59O68S
Absent amino acids: FIMW Common amino acids: AT
pI: 7.36 Basic residues: 6
Polar residues: 15 Hydrophobic residues: 12
Hydrophobicity: -67.5 Boman Index: -8767
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 66.59
Instability Index: 1896.36 Extinction Coefficient cystines: 1490
Absorbance 280nm: 34.65

Literature

  • PubMed ID:  15489334
  • Title:  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
  • PubMed ID:  2413019
  • Title:  The relationship between rat major acute phase protein and the kininogens.
  • PubMed ID:  2413018
  • Title:  Primary structures of the mRNAs encoding the rat precursors for brady